The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the HMG domain of mouse HMG domain protein HMGX2. To be published
    Site RSGI
    PDB Id 2crj Target Id mmi002018633.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13406, Molecular Weight 9513.37 Da.
    Residues 79 Isoelectric Point 8.38
    Sequence pkapvtgyvrflnerreqirtrhpdlpfpeitkmlgaewsklqpaekqryldeaekekqqylkelwayq qseaykvcte
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2crj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch