.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cr5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the UBX domain of D0H8S2298E protein. To be Published
    Site RSGI
    PDB Id 2cr5 Target Id mmi002020622.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13414, Molecular Weight 10967.83 Da.
    Residues 96 Isoelectric Point 5.00
    Sequence evpdlpeepsetaeevvtvalrcpngrvlrrrffkswnsqvlldwmmkvgyhkslyrlstsfprralev eggssledigitvdtvlnveekeqssq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cr5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch