The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of N-terminal domain of speckle-type POZ protein. To be Published
    Site RSGI
    PDB Id 2cr2 Target Id hss001001155.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13245, Molecular Weight 16803.45 Da.
    Residues 146 Isoelectric Point 8.64
    Sequence kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylslylllvscpks evrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldeangllpddkltlfcevsvvq dsvnisgq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2cr2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch