.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cqz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PH0347 protein from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2cqz Target Id pho001000347.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13813, Molecular Weight 20430.78 Da.
    Residues 177 Isoelectric Point 5.14
    Sequence mkvmiekillvqtlkrlprmgwlikgvqepesiadhsfgvafitlvladvlekrgkridvekalkmaiv hdlaeaiitdiplsaqefvdkdkaealvfkkvfpefyelyreyqecsspeaqlvriadkldmilqayqy elsgnknldefweaieeikrlelskyledilnsvgrlka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.60 Rfree 0.22531
    Matthews' coefficent 2.30 Rfactor 0.195
    Waters 171 Solvent Content 44.90

    Ligand Information
    Ligands
    Metals NI (NICKEL) x 6

    Jmol

     
    Google Scholar output for 2cqz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch