The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RNA binding domain of IGF-II mRNA-binding protein 2. To be Published
    Site RSGI
    PDB Id 2cqh Target Id hsi002013968.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12505, Molecular Weight 8953.88 Da.
    Residues 80 Isoelectric Point 9.00
    Sequence mnklyignlspavtaddlrqlfgdrklplagqvllksgyafvdypdqnwairaietlsgkvelhgkime vdysvskklrs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2cqh

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch