The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RNA binding domain of TAR DNA-binding protein-43. To be Published
    Site RSGI
    PDB Id 2cqg Target Id hss001001612
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13272, Molecular Weight 10456.60 Da.
    Residues 90 Isoelectric Point 9.20
    Sequence vkravqktsdlivlglpwktteqdlkeyfstfgevlmvqvkkdlktghskgfgfvrfteyetqvkvmsq rhmidgrwcdcklpnskqsqd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2cqg

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch