The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Zinc-finger domain in KIAA1064 protein. To be Published
    Site RSGI
    PDB Id 2cqe Target Id hsk002101040.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12752, Molecular Weight 9749.45 Da.
    Residues 85 Isoelectric Point 4.67
    Sequence elpkkrelckfyitgfcaraencpymhgdfpcklyhttgncingddcmfshdplteetrelldkmladd aeagaedekeveelkk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2cqe

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch