The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the RNA recognition motif in Arginine/serine-rich splicing factor 10. To be Published
    Site RSGI
    PDB Id 2cqc Target Id hss001003317
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13320, Molecular Weight 9394.00 Da.
    Residues 82 Isoelectric Point 6.45
    Sequence nranpdpncclgvfglslytterdlrevfskygpiadvsivydqqsrrsrgfafvyfenvddakeaker angmeldgrrirv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2cqc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch