.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cqa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-039, a fragment of C-terminal domain of RuvB-like 2 from human cDNA. To be Published
    Site RSGI
    PDB Id 2cqa Target Id hss001000001.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13173, Molecular Weight 8969.83 Da.
    Residues 82 Isoelectric Point 6.51
    Sequence keeteiiegevveiqidrpatgtgskvgkltlkttemetiydlgtkmiesltkdkvqagdvitidkatg kisklgrsftrar
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cqa

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch