The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-044, an N-terminal domain of Glutaredoxin 2 from human cDNA. To be Published
    Site RSGI
    PDB Id 2cq9 Target Id hsi002021569.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12533, Molecular Weight 13389.80 Da.
    Residues 117 Isoelectric Point 8.68
    Sequence slenlatapvnqiqetisdncvvifsktscsyctmakklfhdmnvnykvveldlleygnqfqdalykmt gertvprifvngtfiggatdthrlhkegkllplvhqcylkkskrkefq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2cq9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch