The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-033, a pp-binding domain of 10-FTHFDH from human cDNA. To be Published
    Site RSGI
    PDB Id 2cq8 Target Id hss001000885.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13222, Molecular Weight 10842.63 Da.
    Residues 97 Isoelectric Point 4.29
    Sequence ffkgaassvlelteaelvtaeavrsvwqrilpkvlevedstdffksgaasvdvvrlveevkelcdglel enedvymastfgdfiqllvrklrgddee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2cq8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch