.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cq4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title solution structure of RNA binding domain in RNA binding motif protein 23. To be Published
    Site RSGI
    PDB Id 2cq4 Target Id hsi002012635.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12479, Molecular Weight 11364.47 Da.
    Residues 101 Isoelectric Point 9.58
    Sequence kspvrepvdnlspeerdartvfcmqlaarirprdledffsavgkvrdvriisdrnsrrskgiayvefce iqsvplaigltgqrllgvpiivqasqaeknrl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cq4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch