.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cq1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title solution structure of RNA binding domain in PTB-like protein L. To be Published
    Site RSGI
    PDB Id 2cq1 Target Id hsi002009793.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12424, Molecular Weight 9866.96 Da.
    Residues 88 Isoelectric Point 8.22
    Sequence dkmdgapsrvlhirklpgevtetevialglpfgkvtnilmlkgknqaflelateeaaitmvnyysavtp hlrnqpiyiqysnhkelkt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cq1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch