.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cq0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title solution structure of RNA binding domain in eukaryotic translation initiation factor 3 subunit 4. To be Published
    Site RSGI
    PDB Id 2cq0 Target Id hss001003366
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13321, Molecular Weight 10129.68 Da.
    Residues 90 Isoelectric Point 8.72
    Sequence pnrraddnatirvtnlsedtretdlqelfrpfgsisriylakdkttgqskgfafisfhrredaaraiag vsgfgydhlilnvewakpstn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cq0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch