.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cpq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-terminal KH domain of human FXR1. To be Published
    Site RSGI
    PDB Id 2cpq Target Id hss001001578
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13269, Molecular Weight 8580.23 Da.
    Residues 78 Isoelectric Point 4.83
    Sequence tkqlaaafheefvvredlmglaigthgsniqqarkvpgvtaieldedtgtfriygesadavkkargfle fvedfiqvp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cpq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch