The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RNA recognition motif of human APOBEC-1 complementation factor, ACF. To be Published
    Site RSGI
    PDB Id 2cpd Target Id hss001001710.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13278, Molecular Weight 9702.58 Da.
    Residues 86 Isoelectric Point 5.13
    Sequence dedtmssvkilyvrnlmlstseemiekefnnikpgavervkkirdyafvhfsnredaveamkalngkvl dgspievtlakpvdkds
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2cpd

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch