.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cp3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 2nd CAP-Gly domain in human CLIP-115/CYLN2. To be Published
    Site RSGI
    PDB Id 2cp3 Target Id hsk002100283.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12696, Molecular Weight 7676.50 Da.
    Residues 71 Isoelectric Point 8.73
    Sequence lrlgdrvlvggtktgvvryvgetdfakgewcgveldeplgkndgavagtryfqcppkfglfapihkvir ig
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cp3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch