The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the CAP-Gly domain in human Kinesin-like protein KIF13B. To be Published
    Site RSGI
    PDB Id 2cow Target Id hsk002100622.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12718, Molecular Weight 9480.04 Da.
    Residues 87 Isoelectric Point 5.05
    Sequence qalasdseeadevpewlregefvtvgahktgvvryvgpadfqegtwvgveldlpsgkndgsiggkqyfr cnpgygllvrpsrvrrat
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2cow

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch