The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first and second zf-C2H2 domain of Zinc finger protein 435. To be published
    Site RSGI
    PDB Id 2cot Target Id hss001001726
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13279, Molecular Weight 7665.18 Da.
    Residues 64 Isoelectric Point 9.69
    Sequence rsewqqrerrrykcdecgksfshssdlskhrrthtgekpykcdecgkafiqrshlighhrvhtg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2cot

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch