The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SWIRM domain of human histone demethylase LSD1. Structure 14 457-468 2006
    Site RSGI
    PDB Id 2com Target Id hsk002000585.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12596, Molecular Weight 12717.90 Da.
    Residues 111 Isoelectric Point 8.88
    Sequence eepsgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltfeatlqq leapynsdtvlvhrvhsylerhglinfgiykrikplptkktg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2com

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch