The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the HMG_box domain of thymus high mobility group box protein TOX from mouse. To be Published
    Site RSGI
    PDB Id 2co9 Target Id mmt008001429.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13654, Molecular Weight 10043.02 Da.
    Residues 89 Isoelectric Point 9.76
    Sequence kkkkkkdpnepqkpvsayalffrdtqaaikgqnpnatfgevskivasmwdglgeeqkqvykkkteaakk eylkqlaayraslvsksytd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2co9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch