.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bte

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Leucyl-tRNA Synthetase Complexed with tRNA(Leu) in the Post-Transfer-Editing Conformation. Nat.Struct.Mol.Biol. 12 923 2005
    Site RSGI
    PDB Id 2bte Target Id ar_001000551.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS12186, Molecular Weight 101027.00 Da.
    Residues 878 Isoelectric Point 5.81
    Sequence mekynphaieakwqrfweekgfmkakdlpggrgkqyvlvmfpypsgdlhmghlknytmgdvlarfrrmq gyevlhpmgwdafglpaenaalkfgvhpkdwtyanirqakeslrlmgilydwdrevttcepeyyrwnqw iflkmwekglayrakglvnwcpkcqtvlaneqvvegrcwrhedtpvekreleqwylritayaerllkdl eglnwpekvkamqrawigrsegaeilfpvegkevripvfttrpdtlfgatflvlapehpltlelaapek reevlayveaakrkteierqaegrektgvflgayalnpatgeripiwtadyvlfgygtgaimavpahdq rdyefarkfglpikkvierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawleekglgkgr vtyrlrdwlisrqrywgtpipmvhceacgvvpvpeeelpvllpdlkdvedirpkgkspleahpefyett cpkcggpakrdtdtmdtffdsswyylrytdphndrlpfdpekanawmpvdqyiggvehavlhllysrff tkflhdlgmvkveepfqglftqgmvlawtdfgpvevegsvvrlpeptrirleipesalsledvrkmgae lrphedgtlhlwkpavmskskgngvmvgpfvkeqgadiaritilfaappenemvwteegvqgawrflnr iyrrvaedrealletsgvfqaealegkdrelygklhetlkkvtedlealrfntaiaalmeflnalyeyr kdrpvtpvyrtairyylqmlfpfaphlaeelwhwfwpdslfeagwpeldekalekdvvevavqvngrvr gtihipkdaplevaraealkvrnvrahlegkevvkeiyvpgkilnlvvrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.9 Rfree 0.253
    Matthews' coefficent 3.9 Rfactor 0.217
    Waters 18 Solvent Content 68

    Ligand Information
    Ligands LEU (SULFATE) x 2;SO4 (NORVALINE) x 25;NVA-2AD (2'-AMINO-2'-DEOXYADENOSINE) x 2
    Metals ZN (ZINC) x 4;HG (MERCURY) x 2

    Jmol

     
    Google Scholar output for 2bte

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch