.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bla

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Dihydrofolate Reductase from Plasmodium Vivax: Pyrimethamine Displacement Linked with Mutation-Induced Resistance. Proc.Natl.Acad.Sci.USA 102 13046 2005
    Site RSGI
    PDB Id 2bla Target Id ar_001000501.2
    Molecular Characteristics
    Source Plasmodium vivax
    Alias Ids TPS12170, Molecular Weight 26662.19 Da.
    Residues 232 Isoelectric Point 8.82
    Sequence medlsdvfdiyaicacckvaptsegtknepfsprtfrglgnkgtlpwkcnsvdmkyfrsvttyvdesky eklkwkrerylrmeasqgggdntsggdnnadklqnvvvmgrsnwesipkqykplpnrinvvlsktltke dvkekvfiidsiddlllllkklkyykcfiiggaqvyreclsrnlikqiyftringaypcdvffpefdes qfrvtsvsevynskgttldflvysk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.5 Rfree 0.2818
    Matthews' coefficent 2.86 Rfactor 0.1939
    Waters 151 Solvent Content 56.73

    Ligand Information
    Ligands NDP (NADPH) x 1;CP6 (5-(4-CHLORO-PHENYL)-6-ETHYL-PYRIMIDINE-2,4-) x 1;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 2bla

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch