The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii. To be Published
    Site RSGI
    PDB Id 2bkn Target Id pho001000236.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13800, Molecular Weight 22984.38 Da.
    Residues 205 Isoelectric Point 4.79
    Sequence meeveefkyepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyqlmmhsvlaa rnvkeaeqvitilqianaiedisnaagdlakmvlegvelhpviketilegeeiigkiqvypesvivgkt lgeldlatntgvwiiavrrgkrwifgpnenfkiragdvligrgtrtsidhlkeiargairvignera
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.257
    Matthews' coefficent 2.72 Rfactor 0.226
    Waters 99 Solvent Content 54.43

    Ligand Information
    Metals CS (CESIUM) x 10


    Google Scholar output for 2bkn

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch