The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for transcription inhibition by tagetitoxin. Nat.Struct.Mol.Biol. 12 1086-1093 2005
    Site RSGI
    PDB Id 2be5 Target Id ttk003000780.6
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14432, Molecular Weight 125257.82 Da.
    Residues 1119 Isoelectric Point 5.71
    Sequence meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkgkgglvldfl eyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghiplmtedgsfiingadrvivs qihrspgvyftpdparpgryiasiiplpkrgpwidlevepngvvsmkvnkrkfplvlllrvlgydqetl arelgaygelvqglmdesvfamrpeealirlftllrpgdppkrdkavayvygliadprrydlgeagryk aeeklgirlsgrtlarfedgefkdevflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfr vglarlargvrermlmgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalg pggltreragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvtdev vymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvfsvntnlipfleh ddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedgevakvdgnrivvryedgrlv eyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpasengflalgqnvlvaimpfdgynfedaivi seellkrdfytsihieryeieardtklgperitrdiphlseaalrdldeegvvrigaevkpgdilvgrt sfkgeseptpeerllrsifgekardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyva qkrklqvgdklanrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyfl gqryispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpeeqlkel flqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqplggkaqfggqrfgem evwaleaygaahtlqemltlksddiegrnaayeaiikgedvpepsvpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.274
    Matthews' coefficent 5.20 Rfactor 0.237
    Waters 8184 Solvent Content 75.00

    Ligand Information
    Ligands TGT (TAGETITOXIN) x 2
    Metals MG (MAGNESIUM) x 4;ZN (ZINC) x 4


    Google Scholar output for 2be5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch