.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a6e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins. Cell(Cambridge,Mass.) 122 351-363 2005
    Site RSGI
    PDB Id 2a6e Target Id ttk003000780.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14428, Molecular Weight 125257.82 Da.
    Residues 1119 Isoelectric Point 5.71
    Sequence meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkgkgglvldfl eyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghiplmtedgsfiingadrvivs qihrspgvyftpdparpgryiasiiplpkrgpwidlevepngvvsmkvnkrkfplvlllrvlgydqetl arelgaygelvqglmdesvfamrpeealirlftllrpgdppkrdkavayvygliadprrydlgeagryk aeeklgirlsgrtlarfedgefkdevflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfr vglarlargvrermlmgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalg pggltreragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvtdev vymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvfsvntnlipfleh ddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedgevakvdgnrivvryedgrlv eyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpasengflalgqnvlvaimpfdgynfedaivi seellkrdfytsihieryeieardtklgperitrdiphlseaalrdldeegvvrigaevkpgdilvgrt sfkgeseptpeerllrsifgekardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyva qkrklqvgdklanrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyfl gqryispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpeeqlkel flqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqplggkaqfggqrfgem evwaleaygaahtlqemltlksddiegrnaayeaiikgedvpepsvpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.268
    Matthews' coefficent 5.20 Rfactor 0.231
    Waters 5117 Solvent Content 75.00

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2;ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 2a6e

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch