The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins. Cell(Cambridge,Mass.) 122 351-363 2005
    Site RSGI
    PDB Id 2a69 Target Id ttk003000780.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14429, Molecular Weight 125257.82 Da.
    Residues 1119 Isoelectric Point 5.71
    Sequence meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkgkgglvldfl eyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghiplmtedgsfiingadrvivs qihrspgvyftpdparpgryiasiiplpkrgpwidlevepngvvsmkvnkrkfplvlllrvlgydqetl arelgaygelvqglmdesvfamrpeealirlftllrpgdppkrdkavayvygliadprrydlgeagryk aeeklgirlsgrtlarfedgefkdevflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfr vglarlargvrermlmgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalg pggltreragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvtdev vymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvfsvntnlipfleh ddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedgevakvdgnrivvryedgrlv eyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpasengflalgqnvlvaimpfdgynfedaivi seellkrdfytsihieryeieardtklgperitrdiphlseaalrdldeegvvrigaevkpgdilvgrt sfkgeseptpeerllrsifgekardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyva qkrklqvgdklanrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyfl gqryispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpeeqlkel flqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqplggkaqfggqrfgem evwaleaygaahtlqemltlksddiegrnaayeaiikgedvpepsvpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.267
    Matthews' coefficent 5.20 Rfactor 0.23
    Waters 6399 Solvent Content 75.00

    Ligand Information
    Ligands RPT (RIFAPENTINE) x 2
    Metals MG (MAGNESIUM) x 487;ZN (ZINC) x 4


    Google Scholar output for 2a69

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch