.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zzg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein TT0462 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1zzg Target Id ttk003000462.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14373, Molecular Weight 46078.75 Da.
    Residues 415 Isoelectric Point 5.95
    Sequence mlrldtrflpgfpealsrhgplleearrrllakrgepgsmlgwmdlpedtetlrevrryreanpwvedf vligiggsalgpkaleaafnesgvrfhyldhvepepilrllrtldprktlvnavsksgstaetlaglav flkwlkahlgedwrrhlvvttdpkegplrafaereglkafaipkevggrfsalspvgllplafagadld allmgarkanetalapleeslplktalllhlhrhlpvhvfmvyserlshlpswfvqlhdeslgkvdrqg qrvgttavpalgpkdqhaqvqlfregpldkllalvipeapledveipevegleaasylfgktlfqllka eaeatyealaeagqrvyalflpevspyavgwlmqhlmwqtaflgelwevnafdqpgvelgkvltrkrlag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.193
    Matthews' coefficent 2.50 Rfactor 0.185
    Waters 745 Solvent Content 50.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zzg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch