.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ye5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of PIN-domain protein PH0500 from Pyrococcus horikoshii. Acta Crystallogr.,Sect.F 61 463-468 2005
    Site RSGI
    PDB Id 1ye5 Target Id pho001000500.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13825, Molecular Weight 17189.33 Da.
    Residues 149 Isoelectric Point 5.10
    Sequence mplppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefeilkdiyni vpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkryepirrfgldtmpldkfik evelmvekeli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.273
    Matthews' coefficent 2.10 Rfactor 0.234
    Waters 217 Solvent Content 40.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ye5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch