The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Snapshots of the KMSKS Loop Rearrangement for Amino Acid Activation by Bacterial Tyrosyl-tRNA Synthetase. J.MOL.BIOL. 346 105-117 2005
    Site RSGI
    PDB Id 1x8x Target Id eco001001308.5
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12269, Molecular Weight 47524.49 Da.
    Residues 424 Isoelectric Point 5.59
    Sequence massnlikqlqerglvaqvtdeealaerlaqgpialycgfdptadslhlghlvpllclkrfqqaghkpv alvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgensaiaannydwfgnmnvltf lrdigkhfsvnqminkeavkqrlnredqgisftefsynllqgydfaclnkqygvvlqiggsdqwgnits gidltrrlhqnqvfgltvplitkadgtkfgkteggavwldpkktspykfyqfwintadadvyrflkfft fmsieeinaleeedknsgkapraqyvlaeqvtrlvhgeeglqaakriteclfsgslsalseadfeqlaq dgvpmvemekgadlmqalvdselqpsrgqarktiasnaitingekqsdpeyffkeedrlfgrftllrrg kknyclicwk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.22
    Matthews' coefficent 2.60 Rfactor 0.191
    Waters 218 Solvent Content 51.70

    Ligand Information
    Ligands SO4 (SULFATE) x 1;TYR x 1


    Google Scholar output for 1x8x

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch