.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x6h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the C2H2 type zinc finger domain of human Transcriptional repressor CTCF. To be Published
    Site RSGI
    PDB Id 1x6h Target Id hss001000882.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13220, Molecular Weight 8329.97 Da.
    Residues 73 Isoelectric Point 8.96
    Sequence rthtgekpyacshcdktfrqkqlldmhfkryhdpnfvpaafvcskcgktftrrntmarhadncagpdgv egen
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1x6h

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch