The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the SH3 domain of human megakaryocyte-associated tyrosine-protein kinase. To be Published
    Site RSGI
    PDB Id 1x6g Target Id hsi002004506.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12371, Molecular Weight 7730.51 Da.
    Residues 68 Isoelectric Point 9.81
    Sequence rmptrrwapgtqcitkcehtrpkpgelafrkgdvvtileacenkswyrvkhhtsgqegllaagalrer
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1x6g

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch