The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the second LIM domain of human LIM-kinase 2 (LIMK2). To be Published
    Site RSGI
    PDB Id 1x6a Target Id hsi002010509.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12432, Molecular Weight 7630.48 Da.
    Residues 68 Isoelectric Point 5.68
    Sequence kdywgkfgefchgcsllmtgpfmvagefkyhpecfacmsckviiedgdayalvqhatlycgkchnevv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1x6a

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch