The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the LIM domain of alpha-actinin-2 associated LIM protein. To be Published
    Site RSGI
    PDB Id 1x64 Target Id mmt007120726.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13613, Molecular Weight 8315.19 Da.
    Residues 76 Isoelectric Point 9.04
    Sequence vrapvtkvhggagsaqrmplcdkcgsgivgavvkardkyrhpecfvcadcnlnlkqkgyffvegelyce tharart
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1x64

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch