.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x5y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the fibronectin type-III domain of mouse myosin-binding protein C, Fast-type homolog. To be Published
    Site RSGI
    PDB Id 1x5y Target Id mmt008001054.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13642, Molecular Weight 10703.56 Da.
    Residues 98 Isoelectric Point 4.95
    Sequence ptsapqhltvedvtdttttlkwrppdrigaggidgylveyclegseewvpankepvercgftvkdlptg arilfrvvgvniagrsepatllqpvtire
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1x5y

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch