The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RRM domain in Parp14. To be Published
    Site RSGI
    PDB Id 1x5p Target Id hsi002013680.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12501, Molecular Weight 9405.23 Da.
    Residues 84 Isoelectric Point 5.37
    Sequence erraprkgntlyvygedmtptllrgafspfgniidlsmdpprncafvtyekmesadqavaelngtqves vqlkvniarkqpmld
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1x5p

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch