.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x5g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the second fibronectin type III domain of human Neogenin. To be Published
    Site RSGI
    PDB Id 1x5g Target Id hso002001179.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12959, Molecular Weight 11411.07 Da.
    Residues 103 Isoelectric Point 5.63
    Sequence rvetqpevqlpgpapnlrayaasptsitvtwetpvsgngeiqnyklyymekgtdkeqdvdvsshsytin glkkyteysfrvvaynkhgpgvstpdvavrtlsd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1x5g

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch