The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the VHS domain of human Signal transducing adaptor molecule 2. To be Published
    Site RSGI
    PDB Id 1x5b Target Id hss001000649.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13210, Molecular Weight 16670.41 Da.
    Residues 150 Isoelectric Point 6.42
    Sequence mplftanpfeqdvekatneynttedwslimdicdkvgstpngakdclkaimkrvnhkvphvalqaltll gacvancgkifhlevcsrdfatevraviknkahpkvceklkslmvewseefqkdpqfslisatiksmke egitfppagsqt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1x5b

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch