The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the NUDIX domain from human A/G-specific adenine DNA glycosylase alpha-3 splice isoform. To be Published
    Site RSGI
    PDB Id 1x51 Target Id hsi002005124.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12383, Molecular Weight 15829.40 Da.
    Residues 142 Isoelectric Point 9.53
    Sequence prkasrkppreessatcvleqpgalgaqillvqrpnsgllaglwefpsvtwepseqlqrkallqelqrw agplpathlrhlgevvhtfshikltyqvyglalegqtpvttvppgarwltqeefhtaavstamkkvfrv yqgq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1x51

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch