.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x4w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the zf-AN1 domain from human hypothetical protein FLJ13222. To be Published
    Site RSGI
    PDB Id 1x4w Target Id hsi002022137.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12537, Molecular Weight 6419.12 Da.
    Residues 54 Isoelectric Point 9.15
    Sequence srskqksrrrcfqcqtklelvqqelgscrcgyvfcmlhrlpeqhdctfdhmgrg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1x4w

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch