The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the zf-AN1 domain from human hypothetical protein LOC130617. To be Published
    Site RSGI
    PDB Id 1x4v Target Id hsi002010558.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12433, Molecular Weight 5904.50 Da.
    Residues 50 Isoelectric Point 9.15
    Sequence rkiftnkceragcrqremmkltcercsrnfcikhrhpldhdcsgeghpts
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1x4v

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch