The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the zinc finger HIT domain in protein FON. Protein Sci. 16 1577-1587 2007
    Site RSGI
    PDB Id 1x4s Target Id hss001004088.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13363, Molecular Weight 5092.52 Da.
    Residues 46 Isoelectric Point 7.54
    Sequence mepagpcgfcpagevqparytcprcnapycslrcyrthgtcaenfy
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1x4s

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch