The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of SURP domain in splicing factor 4. To be Published
    Site RSGI
    PDB Id 1x4o Target Id mmk001002415.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13433, Molecular Weight 7595.98 Da.
    Residues 65 Isoelectric Point 5.05
    Sequence kvsppedeeaknlaeklarfiadggpevetialqnnrenqafsflydpnsqgyryyrqkldefrk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1x4o

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch