.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x4n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of KH domain in FUSE binding protein 1. To be Published
    Site RSGI
    PDB Id 1x4n Target Id mmt008000461.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13623, Molecular Weight 8671.44 Da.
    Residues 79 Isoelectric Point 6.78
    Sequence hqqqrsvmteeykvpdgmvgfiigrggeqisriqqesgckiqiapdsgglperscmltgtpesvqsakr lldqivekgr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1x4n

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch