The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of LIM domain in Four and a half LIM domains protein 2. To be Published
    Site RSGI
    PDB Id 1x4l Target Id hsi002014447.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12512, Molecular Weight 6516.04 Da.
    Residues 59 Isoelectric Point 5.63
    Sequence cagctnpisglggtkyisfeerqwhndcfnckkcslslvgrgflterddilcpdcgkdi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1x4l

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch