The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RING finger in RING finger protein 38. To be Published
    Site RSGI
    PDB Id 1x4j Target Id hss001000939
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13225, Molecular Weight 7308.06 Da.
    Residues 62 Isoelectric Point 8.27
    Sequence qlpsyrfnpnnhqseqtlcvvcmcdfesrqllrvlpcnhefhakcvdkwlkanrtcpicrad
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1x4j

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch