The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RRM domain in splicing factor 2. To be Published
    Site RSGI
    PDB Id 1x4c Target Id mmt007105303.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13598, Molecular Weight 11191.79 Da.
    Residues 101 Isoelectric Point 9.21
    Sequence gppsrrsenrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrkedmtyavrkldntkfr shegetayirvkvdgprspsygrsrssgpssg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1x4c

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch