The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the third ig-like domain of Myosin-dinding protein C, slow-type. to be published
    Site RSGI
    PDB Id 1x44 Target Id hso002000567.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12920, Molecular Weight 9976.80 Da.
    Residues 90 Isoelectric Point 5.17
    Sequence imvtkqledttaycgervelecevseddanvkwfkngeeiipgpksryrirvegkkhiliiegatkada aeysvmttggqssaklsvdlk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1x44

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch