The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH3 domain of Endophilin B1 (Sh3g1b1). to be published
    Site RSGI
    PDB Id 1x43 Target Id mmt008001379.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13652, Molecular Weight 7621.16 Da.
    Residues 68 Isoelectric Point 4.50
    Sequence lndlkessnnrkarvlydydaanstelslladevitvfsvvgmdsdwlmgergnqkgkvpitylelln
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1x43

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch