.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x3s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human Rab18 in complex with Gppnhp. To be Published
    Site RSGI
    PDB Id 1x3s Target Id hsi002010139.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12429, Molecular Weight 20601.31 Da.
    Residues 182 Isoelectric Point 4.88
    Sequence mdedvlttlkiliigesgvgksslllrftddtfdpelaatigvdfkvktisvdgnkaklaiwdtagqer frtltpsyyrgaqgvilvydvtrrdtfvkldnwlneletyctrndivnmlvgnkidkenrevdrneglk farkhsmlfieasaktcdgvqcafeelvekiiqtpglwesenqn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.32 Rfree 0.21
    Matthews' coefficent 2.51 Rfactor 0.185
    Waters 230 Solvent Content 51.00

    Ligand Information
    Ligands GNP (PHOSPHOAMINOPHOSPHONIC) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1x3s

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch